PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010088882.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family YABBY
Protein Properties Length: 225aa    MW: 25006.6 Da    PI: 9.0022
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010088882.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY241.71.5e-74111862170
           YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee.......lleelkveeenlksnve.k 88 
                     d+ s s+q+Cyv+CnfC+t+lavsvPs slfk+vtvrCGhCt+llsvn++      +a+++l++ + ++       lle++ +++   +  ++ +
  XP_010088882.1  11 DHLSPSDQLCYVHCNFCDTVLAVSVPSGSLFKTVTVRCGHCTNLLSVNMRGLLL-PSASNQLHQYFGHSlfspqqyLLEDMMMRSPPASNAMVnH 104
                     78899*****************************************88776543.3445567777776666666665555555444333333303 PP

           YABBY  89 eesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                     + +++++    +  +  ++e+p++p v+rPPekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ih gl
  XP_010088882.1 105 QPNPNHDLVIPSRRRAAEQEIPKPPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHLGL 186
                     333333344444478899*****999*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046905.4E-7115186IPR006780YABBY protein
SuperFamilySSF470956.28E-8129179IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.2E-4135178IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0009933Biological Processmeristem structural organization
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010093Biological Processspecification of floral organ identity
GO:0010154Biological Processfruit development
GO:0010158Biological Processabaxial cell fate specification
GO:0010159Biological Processspecification of organ position
GO:0010450Biological Processinflorescence meristem growth
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MSASSAAFSP DHLSPSDQLC YVHCNFCDTV LAVSVPSGSL FKTVTVRCGH CTNLLSVNMR  60
GLLLPSASNQ LHQYFGHSLF SPQQYLLEDM MMRSPPASNA MVNHQPNPNH DLVIPSRRRA  120
AEQEIPKPPV VNRPPEKRQR VPSAYNRFIK DEIQRIKAGN PDISHREAFS AAAKNWAHFP  180
HIHLGLMPDQ PVKKANLRQP EADNMLMKDG FFSTTPAANV GVSPY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00620PBMTransfer from AT2G45190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC1390893e-73KC139089.1 Vitis pseudoreticulata transcription factor YABBY1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088882.11e-168hypothetical protein L484_020870
SwissprotO221521e-92YAB1_ARATH; Axial regulator YABBY 1
TrEMBLW9QRN31e-168W9QRN3_9R
STRINGVIT_15s0048g00550.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20403490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.18e-94YABBY family protein